SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1sb7A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1sb7A
Domain Number 1 Region: 21-359
Classification Level Classification E-value
Superfamily Pseudouridine synthase 3.69e-101
Family tRNA pseudouridine synthase TruD 0.00000000000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1sb7A   PDB: 1sb7   SUPERFAMILY: 1sb7A
Sequence length 368
Comment (A:)
Sequence
gsshhhhhhssglvprgshmiefdnltylhgkpqgtgllkanpedfvvvedlgfepdgeg
ehilvrilkngcntrfvadalakflkiharevsfagqkdkhavteqwlcarvpgkempdl
safqlegcqvleyarhkrklrlgalkgnaftlvlrevsnrddveqrlidicvkgvpnyfg
aqrfgiggsnlqgaqrwaqtntpvrdrnkrsfwlsaarsalfnqivaerlkkadvnqvvd
gdalqlagrgswfvatteelaelqrrvndkelmitaalpgsgewgtqrealafeqaavaa
etelqallvrekveaarramllypqqlswnwwddvtveirfwlpagsfatsvvrelintt
gdyahiae
Download sequence
Identical sequences 1sb7A 1sb7_A 1sb7_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]