SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1sgmA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1sgmA
Domain Number 1 Region: 79-186
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 4.92e-27
Family Tetracyclin repressor-like, C-terminal domain 0.00000103
Further Details:      
 
Domain Number 2 Region: 6-75
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000332
Family Tetracyclin repressor-like, N-terminal domain 0.0000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1sgmA   PDB: 1sgm
Sequence length 191
Comment (A:)
Sequence
mtsrgdsrekilhtasrlsqlqgyhatglnqivkesgapkgslyhffpngkeelaieavt
ytgkivehliqqsmdessdpveaiqlfikktasqfdntesikgipvgllasetalisepl
rtvcmkvfksweavfarklmengfaeeeanqlgtlinsmieggimlsltnkdktplllia
eqipvlvrkkg
Download sequence
Identical sequences APC1840 NYSGXRC-T1414 cath|current|1sgmA00/5-188 cath|current|1sgmB00/5-188 1sgm_A 1sgm_B 1sgmA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]