SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1si7A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1si7A
Domain Number 1 Region: 22-360
Classification Level Classification E-value
Superfamily Pseudouridine synthase 3.69e-101
Family tRNA pseudouridine synthase TruD 0.00000000000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1si7A   PDB: 1si7   SUPERFAMILY: 1si7A
Sequence length 369
Comment (A:)
Sequence
mgsshhhhhhssglvprgshmiefdnltylhgkpqgtgllkanpedfvvvedlgfepdge
gehilvrilkngcntrfvadalakflkiharevsfagqkdkhavteqwlcarvpgkempd
lsafqlegcqvleyarhkrklrlgalkgnaftlvlrevsnrddveqrlidicvkgvpnyf
gaqrfgiggsnlqgaqrwaqtntpvrdrnkrsfwlsaarsalfnqivaerlkkadvnqvv
dgdalqlagrgswfvatteelaelqrrvndkelmitaalpgsgewgtqrealafeqaava
aetelqallvrekveaarramllypqqlswnwwddvtveirfwlpagsfatsvvrelint
tgdyahiae
Download sequence
Identical sequences 1si7A 1si7_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]