SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1sk4A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1sk4A
Domain Number 1 Region: 1-161
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 4.32e-70
Family N-acetylmuramoyl-L-alanine amidase-like 0.00000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1sk4A   PDB: 1sk4   SUPERFAMILY: 1sk4A
Sequence length 163
Comment (A:)
Sequence
pniikrsawearethcpkmnlpakyviiihtagtsctvstdcqtvvrniqsfhmdtrnfc
digyhflvgqdggvyegvgwhiqgshtygfndialgiafigyfvekppnaaaleaaqdli
qcavvegyltpnyllmghsdvvnilspgqalyniistwphfkh
Download sequence
Identical sequences 1sk4_A 001903424|e1sk4A1|285.1.1.1|A:1-163 d1sk4a_ 1sk4A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]