SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1skbA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1skbA
Domain Number 1 Region: 3-438
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 8.86e-113
Family Histidine acid phosphatase 0.0000000000000798
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1skbA   PDB: 1skb   SUPERFAMILY: 1skbA
Sequence length 439
Comment (A:)
Sequence
skscdtvdlgyqcspatshlwgqyspffsledelsvssklpkdcritlvqvlsrhgaryp
tsskskkykklvtaiqanatdfkgkfaflktynytlgaddltpfgeqqlvnsgikfyqry
kalarsvvpfirasgsdrviasgekfiegfqqakladpgatnraapaisviipesetfnn
tldhgvctkfeasqlgdevaanftalfapdiraraekhlpgvtltdedvvslmdmcsfdt
vartsdasqlspfcqlfthnewkkynylqslgkyygygagnplgpaqgigftneliarlt
rspvqdhtstnstlvsnpatfplnatmyvdfshdnsmvsiffalglyngteplsrtsves
akeldgysaswvvpfgarayfetmqcksekeplvralindrvvplhgcdvdklgrcklnd
fvkglswarsggnwgecfs
Download sequence
Identical sequences 1skbA 1sk8_A 1sk9_A 1ska_A 1skb_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]