SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1smbA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1smbA
Domain Number 1 Region: 6-142
Classification Level Classification E-value
Superfamily PR-1-like 4.17e-60
Family PR-1-like 0.00000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1smbA   PDB: 1smb   SUPERFAMILY: 1smbA
Sequence length 154
Comment (A:)
Sequence
MGKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSR
GQCGENLAWASYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKA
SASDGSSFVVARYFPAGNVVNEGFFEENVLPPKK
Download sequence
Identical sequences Q9H4G4
1smb_A 4aiw_A 1smbA gi|11641247|ref|NP_071738.1| 000151711|e4aiwA1|273.1.1.2|A:1-154 ENSP00000367196 ENSP00000367196 ENSP00000367196 NP_071738.1.87134 NP_071738.1.92137 9606.ENSP00000367196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]