SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1smyA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1smyA
Domain Number 1 Region: 50-172
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 3.29e-40
Family Insert subdomain of RNA polymerase alpha subunit 0.000000352
Further Details:      
 
Domain Number 2 Region: 2-50,173-227
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 9.74e-32
Family RNA polymerase alpha subunit dimerisation domain 0.0000101
Further Details:      
 
Domain Number 3 Region: 253-313
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 7.25e-22
Family C-terminal domain of RNA polymerase alpha subunit 0.0000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1smyA   PDB: 1smy
Sequence length 315
Comment (A:)
Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIED
VLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADV
EIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQ
VEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLE
EIKEALEKKGFTLKE
Download sequence
Identical sequences Q5SHR6 Q72I32 Q9Z9H6
gi|55981633|ref|YP_144930.1| 1smyA 1iw7_A 1iw7_B 1iw7_K 1iw7_L 1smy_A 1smy_B 1smy_K 1smy_L 1zyr_A 1zyr_B 1zyr_K 1zyr_L 2a68_A 2a68_B 2a68_K 2a68_L 2a69_A 2a69_B 2a69_K 2a69_L 2a6e_A 2a6e_B 2a6e_K 2a6e_L 2a6h_A 2a6h_B 2a6h_K 2a6h_L 2be5_A 2be5_B 2be5_K 2be5_L 2cw0_A 2cw0_B 2cw0_K 2cw0_L 2o5i_A 2o5i_B 2o5i_K 2o5i_L 2o5j_A 2o5j_B 2o5j_K 2o5j_L 2ppb_A 2ppb_B 2ppb_K 2ppb_L 3aoh_A 3aoh_B 3aoh_F 3aoh_G 3aoh_K 3aoh_L 3aoi_A 3aoi_B 3aoi_F 3aoi_G 3aoi_K 3aoi_L 3dxj_A 3dxj_B 3dxj_K 3dxj_L 3eql_A 3eql_B 3eql_K 3eql_L 3wod_A 3wod_B 4g7h_A 4g7h_B 4g7h_K 4g7h_L 4g7o_A 4g7o_B 4g7o_K 4g7o_L 4g7z_A 4g7z_B 4g7z_K 4g7z_L 4gzy_A 4gzy_B 4gzz_A 4gzz_B 4oin_A 4oin_B 4oio_A 4oio_B 4oip_A 4oip_B 4oiq_A 4oiq_B 4q4z_A 4q4z_B 4q5s_A 4q5s_B 4wqs_A 4wqs_B 4wqs_K 4wqs_L 4wqt_A 4wqt_B 4wqt_F 4wqt_G 4wqt_K 4wqt_L 5d4c_A 5d4c_B 5d4c_K 5d4c_L 5d4d_A 5d4d_B 5d4d_K 5d4d_L 5d4e_A 5d4e_B 5d4e_K 5d4e_L 5e17_A 5e17_B 5e18_A 5e18_B 5i2d_A 5i2d_B 5i2d_L 5i2d_M 5tmc_A 5tmc_B 5tmf_A 5tmf_B 5vo8_A 5vo8_B 5voi_A 5voi_B 5x21_A 5x21_B 5x22_A 5x22_B 5x22_K 5x22_L 5xj0_A 5xj0_B 6asg_A 6asg_B 6cuu_A 6cuu_B 262724.TTC1300 300852.TTHA1664 trt001000270.1 gi|46199602|ref|YP_005269.1| WP_011173698.1.52262 WP_011173698.1.85415 YP_144930.1.19876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]