SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1sqpF from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1sqpF
Domain Number 1 Region: 11-107
Classification Level Classification E-value
Superfamily 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 2.34e-69
Family 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1sqpF   PDB: 1sqp
Sequence length 110
Comment (F:)
Sequence
agrpavsassrwlekirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvf
rikraldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
Download sequence
Identical sequences cath|current|1sqpF00/6-110 1sqpF 1sqp_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]