SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1srqA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1srqA
Domain Number 1 Region: 6-336
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 6.15e-121
Family Rap/Ran-GAP 0.00000000000384
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1srqA   PDB: 1srq   SUPERFAMILY: 1srqA
Sequence length 341
Comment (A:)
Sequence
pttkvklecnptariyrkhflgkehfnyysldtalghlvfslkydvigdqehlrlllrtk
crtyhdvipiscltefpnvvqmaklvcedvnvdrfypvlypkasrlivtfdehvisnnfk
fgviyqklgqtseeelfstneespafvefleflgqkvklqdfkgfrggldvthgqtgtes
vycnfrnkeimfhvstklpytegdaqqlqrkrhigndivavvfqdentpfvpdmiasnfl
hayvvvqaegggpdgplykvsvtarddvpffgpplpdpavfrkgpefqeflltklinaey
acykaekfakleertraalletlyeelhihsqsmmglggde
Download sequence
Identical sequences 1srq_A 1srq_B 1srq_C 1srq_D 1srqA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]