SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1surA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1surA
Domain Number 1 Region: 20-207
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.84e-53
Family PAPS reductase-like 0.0000000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1surA   PDB: 1sur   SUPERFAMILY: 1surA
Sequence length 215
Comment (A:)
Sequence
skldlnalnelpkvdrilalaetnaelekldaegrvawaldnlpgeyvlsssfgiqaavs
lhlvnqirpdipviltdtgylfpetyrfideltdklklnlkvyratesaawqearygklw
eqgvegiekyndinkvepmnralkelnaqtwfaglrreqsgsranlpvlaiqrgvfkvlp
iidwdnrtiyqylqkhglkyhplwdegylsvgdth
Download sequence
Identical sequences 000009847|e1surA1|2005.1.1.136|A:1-215 000317171|e2o8vA1|2005.1.1.136|A:2-216 cath|current|1surA00/1-215 d1sura_ 1sur_A 1surA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]