SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1sxrA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1sxrA
Domain Number 1 Region: 11-177
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 3.88e-62
Family N-acetylmuramoyl-L-alanine amidase-like 0.000000812
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1sxrA   PDB: 1sxr   SUPERFAMILY: 1sxrA
Sequence length 183
Comment (A:)
Sequence
gksrqrspancptiklkrqwggkpslglhyqvrpiryvvihhtvtgecsgllkcaeilqn
mqayhqneldfndisynfligndgivyegtgwglrgahtygynaigtgiafignfvdklp
sdaalqaakdllacgvqqgelsedyaliagsqvistqspgltlyneiqewphwlsnphhh
hhh
Download sequence
Identical sequences cath|current|1sxrA00/11-183 cath|current|1sxrB00/11-183 1sxrA 1sxr_A 1sxr_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]