SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1szdA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1szdA
Domain Number 1 Region: 29-289
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.11e-96
Family Sir2 family of transcriptional regulators 0.0000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1szdA   PDB: 1szd   SUPERFAMILY: 1szdA
Sequence length 297
Comment (A:)
Sequence
masmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlar
lklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqni
dtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelv
kpaivffgedlpdsfsetwlndsewlrekittsgkhpqqplvivvgtslavypfaslpee
iprkvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekiltaq
Download sequence
Identical sequences 1szc_A 1szd_A 1szdA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]