SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1t06A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1t06A
Domain Number 1 Region: 1-235
Classification Level Classification E-value
Superfamily ARM repeat 1.01e-72
Family BC3264-like 0.000000000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1t06A   PDB: 1t06   SUPERFAMILY: 1t06A
Sequence length 235
Comment (A:)
Sequence
MDFKTVMQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAKKIKLNQELAEELYATG
NYDAMYFAGIIADPKAMSESDFDRWIDGAYFYMLSDYVVAVTLSESNIAQDVADKWIASG
DELKMSAGWSCYCWLLGNRKDNAFSESKISDMLEMVKDTIHHSPERTKSAMNNFLNTVAI
SYVPLHEKAVEIAKEVGIVEVKRDNKKSSLLNASESIQKELDRGRLGFKRKYVRC
Download sequence
Identical sequences A0A0T8DCR5 A0A164T7N8 Q81BA8
000004608|e1t06A1|109.4.1.30|A:1-235 000060060|e1t06B1|109.4.1.30|B:1-235 d1t06a_ d1t06b_ d3zboa1 d3zbob_ 1t06A 1t06_A 1t06_B 226900.BC3264 APC24929 gi|30021373|ref|NP_833004.1| NP_833004.1.86172 WP_000346313.1.26637 WP_000346313.1.58822 WP_000346313.1.76902 WP_000346313.1.80649 WP_000346313.1.97842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]