SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1t1dA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1t1dA
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily POZ domain 3.87e-41
Family Tetramerization domain of potassium channels 0.00000674
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1t1dA   PDB: 1t1d   SUPERFAMILY: 1t1dA
Sequence length 100
Comment (A:)
Sequence
ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
qsggrlrrpvnvpldvfseeikfyelgenaferyredegf
Download sequence
Identical sequences 000006269|e1t1dA1|226.1.1.2|A:1-100 cath|current|1t1dA00/66-165 d1t1da_ 1t1d_A 1t1dA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]