SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1t2uA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1t2uA
Domain Number 1 Region: 5-111
Classification Level Classification E-value
Superfamily BRCT domain 3.95e-28
Family BRCT domain 0.00000162
Further Details:      
 
Domain Number 2 Region: 114-212
Classification Level Classification E-value
Superfamily BRCT domain 5.14e-24
Family BRCT domain 0.00000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1t2uA   PDB: 1t2u
Sequence length 214
Comment (A:)
Sequence
vnkrmsmvvsgltpeefmlvykfarkhhitltnliteetthvvmktdaefvcertlkyfl
giaggkwvvsyfwvtqsikerkmlnehdfevrgdvvngrnhqgpkraresqdrkifrgle
iccygpftnmptdqlewmvqlcgasvvkelssftlgtgvhpivfvqpdawtedngfhaig
qmceapvvtrewvldsvalyqcqeldtylipqip
Download sequence
Identical sequences 1t2u_A 1t2uA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]