SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1t3aA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1t3aA
Domain Number 1 Region: 2-411
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.27e-161
Family Clostridium neurotoxins, catalytic domain 0.000000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1t3aA   PDB: 1t3a   SUPERFAMILY: 1t3aA
Sequence length 421
Comment (A:)
Sequence
pkinsfnyndpvndrtilyikpggcqefyksfnimkniwiipernvigttpqdfhpptsl
kngdssyydpnylqsdeekdrflkivtkifnrinnnlsggilleelskanpylgndntpd
nqfhigdasaveikfsngsqdillpnviimgaepdlfetnssnislrnnympsnhgfgsi
aivtfspeysfrfndnsmnefiqdpaltlmhelihslhglygakgittkytitqkqnpli
tnirgtnieefltfggtdlniitsaqsndiytnlladykkiasklskvqvsnpllnpykd
vfeakygldkdasgiysvninkfndifkklysftefdlatkfqvkcrqtyigqykyfkls
nllndsiynisegyninnlkvnfrgqnanlnpriitpitgrglvkkiirfcknivsvkgi
r
Download sequence
Identical sequences 1t3a_A 1t3a_B cath|current|1t3aA00/1-411 cath|current|1t3aB00/1-409 1t3aA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]