SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1t98A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1t98A
Domain Number 1 Region: 119-281
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 4.39e-78
Family MukF C-terminal domain-like 0.000000026
Further Details:      
 
Domain Number 2 Region: 8-118
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.1e-48
Family MukF N-terminal domain-like 0.00000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1t98A   PDB: 1t98
Sequence length 287
Comment (A:)
Sequence
msefsqtvpelvawarkndfsislpvdrlsfllavatlngerldgemsegelvdafrhvs
dafeqtsetigvrannaindmvrqrllnrftseqaegnaiyrltplgigitdyyirqref
stlrlsmqlsivagelkraadaaeeggdefhwhrnvyaplkysvaeifdsidltqrlmde
qqqqvkddiaqllnkdwraaisscelllsetsgtlrelqdtleaagdklqanllriqdat
mthddlhfvdrlvfdlqskldriiswgqqsidlwigydrhvhkfirt
Download sequence
Identical sequences 1t98_A 1t98_B 1t98A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]