SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1t9bA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1t9bA
Domain Number 1 Region: 461-637
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.1e-103
Family Pyruvate oxidase and decarboxylase PP module 0.00000000371
Further Details:      
 
Domain Number 2 Region: 83-246
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.35e-99
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000000596
Further Details:      
 
Domain Number 3 Region: 278-425
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.09e-68
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1t9bA   PDB: 1t9b
Sequence length 677
Comment (A:)
Sequence
mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamgsapsfnvdpleqpa
epsklakklraepdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdk
fnfvlpkheqgaghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgq
vptsaigtdafqeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlp
kdvtaailrnpiptkttlpsnalnqltsraqdefvmqsinkaadlinlakkpvlyvgagi
lnhadgprllkelsdraqipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadli
iavgarfddrvtgniskfapearraaaegrggiihfevspkninkvvqtqiavegdattn
lgkmmskifpvkersewfaqinkwkkeypyaymeetpgskikpqtvikklskvandtgrh
vivttgvgqhqmwaaqhwtwrnphtfitsgglgtmgyglpaaigaqvakpeslvididgd
asfnmtltelssavqagtpvkililnneeqgmvtqwqslfyehryshthqlnpdfiklae
amglkglrvkkqeeldaklkefvstkgpvllevevdkkvpvlpmvaggsgldefinfdpe
verqqtelrhkrtggkh
Download sequence
Identical sequences 1n0h_A 1n0h_B 1t9a_A 1t9a_B 1t9b_A 1t9b_B 1t9c_A 1t9c_B 1t9d_A 1t9d_B 1t9d_C 1t9d_D 5fem_A 5fem_B 5ims_A 5ims_B 5wkc_A 5wkc_B 5wkc_D 5wkc_E 6bd3_A 6bd3_B 6bd9_A 6bd9_B 1t9bA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]