SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1tf0A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1tf0A
Domain Number 1 Region: 200-378
Classification Level Classification E-value
Superfamily Serum albumin-like 5.1e-77
Family Serum albumin-like 0.00056
Further Details:      
 
Domain Number 2 Region: 389-572
Classification Level Classification E-value
Superfamily Serum albumin-like 1e-72
Family Serum albumin-like 0.00082
Further Details:      
 
Domain Number 3 Region: 6-186
Classification Level Classification E-value
Superfamily Serum albumin-like 1.02e-69
Family Serum albumin-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1tf0A   PDB: 1tf0
Sequence length 572
Comment (A:)
Sequence
dahksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesae
ncdkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpev
dvmctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllp
kldelrdegkassakqrlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltk
vhtecchgdllecaddradlakyicenqdsissklkeccekpllekshciaevendempa
dlpslaadfveskdvcknyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekc
caaadphecyakvfdefkplveepqnlikqncelfeqlgeykfqnallvrytkkvpqvst
ptlvevsrnlgkvgskcckhpeakrmpcaedylsvvlnqlcvlhektpvsdrvtkcctes
lvnrrpcfsalevdetyvpkefnaetftfhadictlsekerqikkqtalvelvkhkpkat
keqlkavmddfaafvekcckaddketcfaeeg
Download sequence
Identical sequences 1tf0A 1tf0_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]