SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1tghA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1tghA
Domain Number 1 Region: 95-179
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 8.2e-55
Family TATA-box binding protein (TBP), C-terminal domain 0.02
Further Details:      
 
Domain Number 2 Region: 10-89
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 5.24e-54
Family TATA-box binding protein (TBP), C-terminal domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1tghA   PDB: 1tgh
Sequence length 185
Comment (A:)
Sequence
gsrgsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalif
ssgkmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglv
lthqqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkg
frktt
Download sequence
Identical sequences 1tgh_A 1tghA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]