SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1tj2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1tj2A
Domain Number 1 Region: 235-582
Classification Level Classification E-value
Superfamily PDB 9.13e-231
Family PDB 0.000000000632
Further Details:      
 
Domain Number 2 Region: 177-533
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.45e-124
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00000000000299
Further Details:      
 
Domain Number 3 Region: 3-176
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.32e-67
Family N-terminal domain of bifunctional PutA protein 0.0000000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1tj2A   PDB: 1tj2
Sequence length 584
Comment (A:)
Sequence
lpqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgra
gmvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslf
vnaatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvtgeti
aealanarkleekgfrysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiyegpg
isiklsalhprysraqydrvmeelyprlksltllarqydiginidaeesdrleisldlle
klcfepelagwngigfviqayqkrcplvidylidlatrsrrrlmirlvkgaywdseikra
qmdglegypvytrkvytdvsylacakkllavpnliypqfathnahtlaaiyqlagqnyyp
gqyefqclhgmgeplyeqvtgkvadgklnrpcriyapvgthetllaylvrrllengants
fvnriadtslpldelvadpvtaveklaqqegqtglphpkiplprdlyghgrdnsagldla
nehrlaslssallnsalqkwqalpmleqpvaagemspvinpaep
Download sequence
Identical sequences 1tj2_A 1tj2A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]