SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1tq8A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1tq8A
Domain Number 1 Region: 16-157
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.45e-30
Family Universal stress protein-like 0.000000482
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1tq8A   PDB: 1tq8   SUPERFAMILY: 1tq8A
Sequence length 163
Comment (A:)
Sequence
mghhhhhhgghmslsayktvvvgtdgsdssmravdraaqiagadakliiasaylpqheda
raadilkdesykvtgtapiyeilhdakerahnagaknveerpivgapvdalvnladeeka
dllvvgnvglstiagrllgsvpanvsrrakvdvlivhtteggs
Download sequence
Identical sequences 1tq8_A 1tq8_B 1tq8_C 1tq8_D 1tq8_E 1tq8_F 1tq8A NYSGXRC-T1533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]