SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1tqgA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1tqgA
Domain Number 1 Region: 5-101
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 9.52e-40
Family Chemotaxis protein CheA P1 domain 0.00000516
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1tqgA   PDB: 1tqg   SUPERFAMILY: 1tqgA
Sequence length 105
Comment (A:)
Sequence
gshmeylgvfvdetkeylqnlndtlleleknpedmelineafralhtlkgmagtmgfssm
aklchtlenildkarnseikitsdlldkifagvdmitrmvdkivs
Download sequence
Identical sequences 000003722|e1tqgA1|601.3.1.1|A:1-105 cath|current|1tqgA00/0-104 1tqgA 1tqg_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]