SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1tr9A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1tr9A
Domain Number 1 Region: 3-282
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.61e-116
Family NagZ-like 0.000000543
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1tr9A   PDB: 1tr9   SUPERFAMILY: 1tr9A
Sequence length 341
Comment (A:)
Sequence
slgplwldvagyelsaedreilqhptvggvilfgrnyhdnqqllalnkairqaakrpili
gvdqeggrvqrfregfsrippaqyyaraengvelaeqggwlmaaeliahdvdlsfapvld
mgfackaignrafgedvqtvlkhssaflrgmkavgmattgkhfpghgaviadshletpyd
eretiaqdmaifraqieagvldammpahvvyphydaqpasgssywlkqvlreelgfkgiv
fsddlsmegaavmggpvershqalvagcdmilicnkreaavevldnlpimevpqaeallk
kqqfsyselkrlerwqqasanmqrlieqfseeggshhhhhh
Download sequence
Identical sequences 1tr9_A 1tr9A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]