SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1tu1A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1tu1A
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 7.17e-48
Family PA0094-like 0.0000000629
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1tu1A   PDB: 1tu1   SUPERFAMILY: 1tu1A
Sequence length 148
Comment (A:)
Sequence
ghmtlyrlheadleipdawqdqsinifklpasgpareasfvisrdasqgdapfadyvarq
lenaekqlpgfklhkrwdinihghaavlldyqwqregrdlmlrqvfierrpavlittltt
tpadlphhepawkqamqtlvprptpsgs
Download sequence
Identical sequences 1tu1A 1tu1_A 1tu1_B cath|current|1tu1A00/-1-142 cath|current|1tu1B00/-1-142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]