SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1tuvA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1tuvA
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 2.84e-30
Family PA3566-like 0.000007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1tuvA   PDB: 1tuv   SUPERFAMILY: 1tuvA
Sequence length 114
Comment (A:)
Sequence
mltviaeirtrpgqhhrqavldqfakivptvlkeegchgyapmvdcaagvsfqsmapdsi
vmieqwesiahleahlqtphmkayseavkgdvlemnirilqpgisgrvhhhhhh
Download sequence
Identical sequences 1tuvA 1tuv_A cath|current|1tuvA00/1-103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]