SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1u14A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1u14A
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily ITPase-like 5.47e-56
Family YjjX-like 0.0000000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1u14A   PDB: 1u14   SUPERFAMILY: 1u14A
Sequence length 172
Comment (A:)
Sequence
amhqvisattnpakiqailqafeeifgegschitpvavesgvpeqpfgseetragarnrv
dnarrlhpqadfwvaieagidddatfswvvidngvqrgearsatlplpavildrvrqgea
lgpvmsqytgideigrkegaigvftagkltrssvyyqavilalspfhnavyr
Download sequence
Identical sequences 1u14_A 1u14A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]