SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1u5wA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1u5wA
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily ITPase-like 4.69e-58
Family YjjX-like 0.0000000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1u5wA   PDB: 1u5w
Sequence length 184
Comment (A:)
Sequence
mlimhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarn
rvanarrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvreg
ealgpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavysgrvehh
hhhh
Download sequence
Identical sequences 1u5w_A 1u5w_B 1u5w_C 1u5w_D 1u5w_E 1u5w_F 1u5w_G 1u5w_H cath|current|1u5wA00/4-174 cath|current|1u5wB00/3-174 cath|current|1u5wC00/2-175 cath|current|1u5wD00/3-174 cath|current|1u5wE00/3-174 cath|current|1u5wF00/4-175 cath|current|1u5wG00/2-174 cath|current|1u5wH00/4-173 1u5wA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]