SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1u6kA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1u6kA
Domain Number 1 Region: 3-283
Classification Level Classification E-value
Superfamily F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 6.22e-127
Family F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 0.0000000000703
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1u6kA   PDB: 1u6k
Sequence length 283
Comment (A:)
Sequence
MTVAKAIFIKCGNLGTSMMMDMLLDERADREDVEFRVVGTSVKMDPECVEAAVEMALDIA
EDFEPDFIVYGGPNPAAPGPSKAREMLADSEYPAVIIGDAPGLKVKDEMEEQGLGYILVK
PDAMLGARREFLDPVEMAIYNADLMKVLAATGVFRVVQEAFDELIEKAKEDEISENDLPK
LVIDRNTLLEREEFENPYAMVKAMAALEIAENVADVSVEGCFVEQDKERYVPIVASAHEM
MRKAAELADEARELEKSNDAVLRTPHAPDGKVLSKRKFMEDPE
Download sequence
Identical sequences P94951
gi|20093451|ref|NP_613298.1| 190192.MK0011 1u6kA 1qv9_A 1qv9_B 1qv9_C 1u6i_A 1u6i_B 1u6i_C 1u6i_D 1u6i_E 1u6i_F 1u6i_G 1u6i_H 1u6i_I 1u6i_J 1u6i_K 1u6i_L 1u6j_A 1u6j_B 1u6j_C 1u6j_D 1u6j_E 1u6j_F 1u6j_G 1u6j_H 1u6j_I 1u6j_J 1u6j_K 1u6j_L 1u6k_A 1u6k_B 1u6k_C 3iqe_A 3iqe_B 3iqe_C 3iqe_D 3iqe_E 3iqe_F 3iqf_A 3iqf_B 3iqf_C 3iqf_D 3iqf_E 3iqf_F 3iqf_G 3iqf_H 3iqf_I 3iqf_J 3iqf_K 3iqf_L 3iqz_A 3iqz_B 3iqz_C 3iqz_D 3iqz_E 3iqz_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]