SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1u84A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1u84A
Domain Number 1 Region: 7-84
Classification Level Classification E-value
Superfamily YugE-like 1.46e-24
Family YugE-like 0.00000629
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1u84A   PDB: 1u84   SUPERFAMILY: 1u84A
Sequence length 90
Comment (A:)
Sequence
snamdgqqlnrlllewigawdpfglgkdaydveaasvlqavyetedartlaariqsiyef
afdepipfphclklarrllelkqaascplp
Download sequence
Identical sequences APC36109 1u84A cath|current|1u84A00/3-83 1u84_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]