SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1uaiA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1uaiA
Domain Number 1 Region: 6-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.2e-88
Family Alginate lyase 0.0000000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1uaiA   PDB: 1uai   SUPERFAMILY: 1uaiA
Sequence length 224
Comment (A:)
Sequence
aepcdypaqqldltdwkvtlpigssgkpseieqpaldtfatapwfqvnakctgvqfraav
ngvttsgsgyprselremtdggeekaswsatsgthtmvfreafnhlpevkphlvgaqihd
gdddvtvfrlegtslyitkgddthhklvtsdyklntvfegkfvvsggkikvyyngvlqtt
ishtssgnyfkagaytqancsnsspcsssnygqvslyklqvths
Download sequence
Identical sequences 1uaiA cath|current|1uaiA00/2-224 1uai_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]