SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ug0A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ug0A
Domain Number 1 Region: 6-82
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 1.17e-23
Family Surp module (SWAP domain) 0.00000656
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ug0A   PDB: 1ug0   SUPERFAMILY: 1ug0A
Sequence length 88
Comment (A:)
Sequence
gssgssgeedyeqwleikvsppegaetrrvieklarfvaeggpelekvamedykdnpaft
flhdknsreflyyrrkvaeirksgpssg
Download sequence
Identical sequences 1ug0_A 1ug0A 001032733|e1ug0A1|574.1.1.2|A:1-88

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]