SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1uhsA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1uhsA
Domain Number 1 Region: 6-65
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000101
Family Homeodomain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1uhsA   PDB: 1uhs   SUPERFAMILY: 1uhsA
Sequence length 72
Comment (A:)
Sequence
gsegaatmtedqveileynfnkvnkhpdpttlcliaaeaglteeqtqkwfkqrlaewrrs
eglpsecrsvtd
Download sequence
Identical sequences 1uhsA 000002464|e1uhsA1|101.1.1.10|A:1-72 1uhs_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]