SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1umdA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1umdA
Domain Number 1 Region: 32-365
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.9e-108
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000000000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1umdA   PDB: 1umd   SUPERFAMILY: 1umdA
Sequence length 367
Comment (A:)
Sequence
MVKETHRFETFTEEPIRLIGEEGEWLGDFPLDLEGEKLRRLYRDMLAARMLDERYTILIR
TGKTSFIAPAAGHEAAQVAIAHAIRPGFDWVFPYYRDHGLALALGIPLKELLGQMLATKA
DPNKGRQMPEHPGSKALNFFTVASPIASHVPPAAGAAISMKLLRTGQVAVCTFGDGATSE
GDWYAGINFAAVQGAPAVFIAENNFYAISVDYRHQTHSPTIADKAHAFGIPGYLVDGMDV
LASYYVVKEAVERARRGEGPSLVELRVYRYGPHSSADDDSRYRPKEEVAFWRKKDPIPRF
RRFLEARGLWNEEWEEDVREEIRAELERGLKEAEEAGPVPPEWMFEDVFAEKPWHLLRQE
ALLKEEL
Download sequence
Identical sequences Q5SLR4
gi|55980198|ref|YP_143495.1| YP_143495.1.19876 1umdA 1um9_A 1um9_C 1umb_A 1umb_C 1umc_A 1umc_C 1umd_A 1umd_C 300852.TTHA0229 cath|current|1um9A00/6-367 cath|current|1um9C00/7-367 cath|current|1umbA00/6-367 cath|current|1umbC00/6-366 cath|current|1umcA00/6-367 cath|current|1umcC00/6-366 cath|current|1umdA00/6-367 cath|current|1umdC00/6-366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]