SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1umqA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1umqA
Domain Number 1 Region: 25-77
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000196
Family FIS-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1umqA   PDB: 1umq   SUPERFAMILY: 1umqA
Sequence length 81
Comment (A:)
Sequence
mgsshhhhhhssglvprgshmlakgeslppppenpmsadrvrwehiqriyemcdrnvset
arrlnmhrrtlqrilakrspr
Download sequence
Identical sequences 1umqA 1umq_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]