SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1un7A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1un7A
Domain Number 1 Region: 62-362
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 1.19e-96
Family N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain 0.0000000000384
Further Details:      
 
Domain Number 2 Region: 8-61,362-395
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 5.77e-19
Family N-acetylglucosamine-6-phosphate deacetylase, NagA 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1un7A   PDB: 1un7
Sequence length 400
Comment (A:)
Sequence
nagamaesllikdiaivtenevikngyvgindgkistvsterpkepyskeiqapadsvll
pgmidihihggygadtmdasfstldimssrlpeegttsflattitqehgnisqalvnare
wkaaeessllgaellgihlegpfvspkragaqpkewirpsdvelfkkwqqeagglikivt
lapeedqhfelirhlkdesiiasmghtdadsallsdaakagashmthlynamspfhhrep
gvigtalahdgfvteliadgihshplaaklaflakgssklilitdsmrakglkdgvyefg
gqsvtvrgrtallsdgtlagsilkmnegarhmreftncswtdianitsenaakqlgifdr
kgsvtvgkdadlvivssdcevilticrgniafiskeadqi
Download sequence
Identical sequences 1un7A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]