SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1us7B from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1us7B
Domain Number 1 Region: 36-233
Classification Level Classification E-value
Superfamily Hsp90 co-chaperone CDC37 2.64e-81
Family Hsp90 co-chaperone CDC37 0.0000000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1us7B   PDB: 1us7   SUPERFAMILY: 1us7B
Sequence length 265
Comment (B:)
Sequence
mrgshhhhhhgmasmvntkpekteedseevreqkhktfvekyekqikhfgmlrrwddsqk
ylsdnvhlvceetanylviwcidleveekcalmeqvahqtivmqfilelakslkvdprac
frqfftkiktadrqymegfndeleafkervrgraklriekamkeyeeeerkkrlgpggld
pvevyeslpeelqkcfdvkdvqmlqdaiskmdptdakyhmqrcidsglwvpnskaseake
geeagpgdplleavpktgdekdvsv
Download sequence
Identical sequences 1us7_B 1us7B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]