SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1usyA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1usyA
Domain Number 1 Region: 2-271
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.69e-31
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1usyA   PDB: 1usy   SUPERFAMILY: 1usyA
Sequence length 275
Comment (A:)
Sequence
MDFLDFEKVFSFYSKATKKGFSPFFVPALEKAEEPAGNFFLDRKGNLFSIREDFTKTVLN
HRKRYSPDSQIKVWYADFVYRYSGSDLVAEYQLGLEKVPRNSLDDSLEVLEIIVESASEF
FEGPVIVEIGHTGVYEDLLKEIPKDLHEKVLNLIDTKNLAEIEFLSHMKKIDLSRVEKII
EDSIYRRSPEHLKTMDLPLSVREDLLSASSFLQEKFPTVSVEIDLTLARTIEEYCGLIFT
IYDTSSSRLVAAGGEYTVNGEKGVGGSIFLEGKTC
Download sequence
Identical sequences Q9X0D3
1usyA gi|15643801|ref|NP_228849.1| 282910 APC4552 NP_228849.1.35502 WP_010865251.1.29620 WP_010865251.1.45724 WP_010865251.1.51363 WP_010865251.1.56403 WP_010865251.1.79805 gi|15643801|ref|NP_228849.1| 243274.TM1043 1usy_A 1usy_B 1usy_D 000007024|e1usyA1|314.1.1.12|A:1-275 000079584|e1usyB1|314.1.1.12|B:1-275 cath|current|1usyA00/1-275 cath|current|1usyB00/1-275 cath|current|1usyD00/2-275 d1usya_ d1usyb_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]