SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1usyC from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1usyC
Domain Number 1 Region: 2-271
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.51e-30
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1usyC   PDB: 1usy   SUPERFAMILY: 1usyC
Sequence length 275
Comment (C:)
Sequence
mdfldfekvfsfyskatkkgfspffvpalekaeepagnffldrkgnlfsiredftktvln
hrkryspesqikvwyadfvyrysgsdlvaeyqlglekvprnslddslevleiivesasef
fegpviveightglyedllkeipkdlhekvlnlidtknlaeieflshmkkidlsrvekii
edsiyrrspehlktmdlplsvredllsassflqekfptvsveidltlartieeycglift
iydtsssrlvaaggeytvngekgvggsiflegktc
Download sequence
Identical sequences 1usyC 1usy_C 000079586|e1usyC1|314.1.1.12|C:1-275 cath|current|1usyC00/1-275 d1usyc_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]