SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1v11A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1v11A
Domain Number 1 Region: 28-395
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.36e-115
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0000000000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1v11A   PDB: 1v11   SUPERFAMILY: 1v11A
Sequence length 400
Comment (A:)
Sequence
sslddkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlkl
yksmtllntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlm
yrdyplelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakr
ananrvvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgia
argpgygimsirvdgndvfavynatkearrravaenqpflieamtyaighastsddssay
rsvdevnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnp
nllfsdvyqempaqlrkqqeslarhlqtygehypldhfdk
Download sequence
Identical sequences 1v11_A 1v11A cath|current|1v11A00/7-400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]