SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1v1hA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1v1hA
Domain Number 1 Region: 56-103
Classification Level Classification E-value
Superfamily Fibritin 3.59e-19
Family Fibritin 0.00051
Further Details:      
 
Domain Number 2 Region: 2-73
Classification Level Classification E-value
Superfamily Fibre shaft of virus attachment proteins 0.0000000000000703
Family Adenovirus 0.0000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1v1hA   PDB: 1v1h
Sequence length 103
Comment (A:)
Sequence
vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
aglsfdnsgaitiggsgyipeaprdgqayvrkdgewvllstfl
Download sequence
Identical sequences 1v1h_A 1v1h_B 1v1h_C 1v1h_D 1v1h_E 1v1h_F 1v1hA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]