SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1v1iA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1v1iA
Domain Number 1 Region: 56-109
Classification Level Classification E-value
Superfamily Fibritin 4.25e-16
Family Fibritin 0.00056
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily Fibre shaft of virus attachment proteins 0.0000000000000425
Family Adenovirus 0.00000904
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1v1iA   PDB: 1v1i
Sequence length 109
Comment (A:)
Sequence
vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
aglsfdnsgaitignknddkgsgyipeaprdgqayvrkdgewvllstfl
Download sequence
Identical sequences 1v1iA 1v1i_A 1v1i_B 1v1i_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]