SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1v4pA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1v4pA
Domain Number 1 Region: 5-149
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.1e-39
Family AlaX-like 0.000000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1v4pA   PDB: 1v4p   SUPERFAMILY: 1v4pA
Sequence length 157
Comment (A:)
Sequence
MYSIEVRTHSALHVVKGAVVKVLGSEAKWTYSTYVKGNKGVLIVKFDRKPSDEEIREIER
LANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEH
TKTTGEIGPIKIRKVRFRKSKGLLEIHFELLELENPS
Download sequence
Identical sequences O58307
70601.PH0574 WP_010884673.1.38245 1v4p_A 1v4p_B 1v4p_C 1wxo_A 1wxo_B 1wxo_C 1v4pA gi|14590471|ref|NP_142539.1| pho001000574.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]