SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1v5fA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1v5fA
Domain Number 1 Region: 362-582
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.03e-54
Family Pyruvate oxidase and decarboxylase PP module 0.00000000181
Further Details:      
 
Domain Number 2 Region: 186-358
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 9.79e-42
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000000194
Further Details:      
 
Domain Number 3 Region: 2-173
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.28e-39
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1v5fA   PDB: 1v5f
Sequence length 589
Comment (A:)
Sequence
nkiniglavmkileswgadtiygipsgtlsslmdamgeeennvkflqvkheevgamaavm
qskfggnlgvtvgsggpgashlinglydaamdnipvvailgsrpqrelnmdafqelnqnp
mydhiavynrrvayaeqlpklvdeaarmaiakrgvavlevpgdfakveidndqwyssans
lrkyapiapaaqdidaavellnnskrpviyagigtmghgpavqelarkikapvittgknf
etfewdfealtgstyrvgwkpanetileadtvlfagsnfpfsevegtfrnvdnfiqidid
pamlgkrhhadvailgdaalaideilnkvdaveesawwtanlknianwreyinmletkee
gdlqfyqvynainnhadedaiysidvgnstqtsirhlhmtpknmwrtsplfatmgiaipg
glgakntypdrqvwniigdgafsmtypdvvtnvrynmpvinvvfsnteyafiknkyedtn
knlfgvdftdvdyakiaeaqgakgftvsriedmdrvmaeavaankaghtvvidckitqdr
pipvetlkldsklysedeikaykeryeaanlvpfreyleaegleskyik
Download sequence
Identical sequences 1v5f_A 1v5g_A 1v5fA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]