SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1v7oA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1v7oA
Domain Number 1 Region: 5-149
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 7.32e-39
Family AlaX-like 0.000000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1v7oA   PDB: 1v7o   SUPERFAMILY: 1v7oA
Sequence length 165
Comment (A:)
Sequence
mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
tkttgeigpikirkvrfrkskglleihfellelenpslehhhhhh
Download sequence
Identical sequences 1v7oA 1v7o_A 1v7o_B 1wnu_A 1wnu_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]