SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1v7rA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1v7rA
Domain Number 1 Region: 2-180
Classification Level Classification E-value
Superfamily ITPase-like 1.01e-73
Family ITPase (Ham1) 0.000000092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1v7rA   PDB: 1v7r   SUPERFAMILY: 1v7rA
Sequence length 186
Comment (A:)
Sequence
MKIFFITSNPGKVREVANFLGTFGIEIVQLKHEYPEIQAEKLEDVVDFGISWLKGKVPEP
FMIEDSGLFIESLKGFPGVYSSYVYRTIGLEGILKLMEGAEDRRAYFKSVIGFYIDGKAY
KFSGVTWGRISNEKRGTHGFGYDPIFIPEGSEKTFAEMTIEEKNALSHRGKALKAFFEWL
KVNLKY
Download sequence
Identical sequences O59580
70601.PH1917 pho001001917.1 pho001001917.2 pho001001917.3 pho001001917.4 pho001001917.6 1v7r_A 2dvn_A 2dvn_B 2dvo_A 2dvp_A 2zti_A gi|14591659|ref|NP_143746.1| 1v7rA 000010333|e1v7rA1|2111.12.1.2|A:1-186 000107491|e2dvnA1|2111.12.1.2|A:1-186 000107494|e2dvnB1|2111.12.1.2|B:1-186 cath|current|1v7rA00/1-186 cath|current|2dvnA00/1-186 cath|current|2dvnB00/1-186 cath|current|2dvoA00/1-185 cath|current|2dvpA00/1-184 cath|current|2ehkA00/1-184 cath|current|2ehkB00/1-184 cath|current|2ztiA00/1-184 d1v7ra_ d2dvna_ d2dvnb_ WP_010885982.1.38245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]