SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1va0A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1va0A
Domain Number 1 Region: 1-223
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 5.57e-95
Family Tetrapyrrole methylase 0.000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1va0A   PDB: 1va0
Sequence length 239
Comment (A:)
Sequence
grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeegesek
qeeihrlllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasgl
plthrglahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpre
ptlfverastpkerrvharleevaegkvevrppalwilgevvrvfaekeapvdalalgg
Download sequence
Identical sequences 1va0A 1v9a_A 1v9a_B 1va0_A 1va0_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]