SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1vavA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1vavA
Domain Number 1 Region: 2-221
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-82
Family Alginate lyase 0.0000000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1vavA   PDB: 1vav   SUPERFAMILY: 1vavA
Sequence length 222
Comment (A:)
Sequence
pdlstwnltipqgrpaitistsqlqrdyrsdyfqrtadgirfwvpvngshtrnsefprse
lretlssgrpynwryaradnwleatlrieavpstrrmiigqihsdgsnsgqaaplvklly
qlrldqgrvqalvrerpddggtraytlmdgiplgqpfsyrigvsrsgllsvsvngsaleq
qldpqwayqglyfkaglylqdnrgpsseggratfselrvshq
Download sequence
Identical sequences 1vavA 000001094|e1vavA1|10.1.1.1|A:1-222 000030083|e1vavB1|10.1.1.1|B:1-222 cath|current|1vavA00/2-223 cath|current|1vavB00/2-223 d1vava_ d1vavb_ 1vav_A 1vav_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]