SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1vbkA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1vbkA
Domain Number 1 Region: 1-175
Classification Level Classification E-value
Superfamily THUMP domain-like 3.9e-51
Family THUMP domain 0.0000000253
Further Details:      
 
Domain Number 2 Region: 178-307
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.13e-22
Family ThiI-like 0.000000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1vbkA   PDB: 1vbk
Sequence length 307
Comment (A:)
Sequence
MNVVIVRYGEIGTKSRQTRSWFEKILMNNIREALVTEEVPYKEIFSRHGRIIVKTNSPKE
AANVLVRVFGIVSISPAMEVEASLEKINRTALLMFRKKAKEVGKERPKFRVTARRITKEF
PLDSLEIQAKVGEYILNNENCEVDLKNYDIEIGIEIMQGKAYIYTEKIKGWGGLPIGTEG
RMIGILHDELSALAIFLMMKRGVEVIPVYIGKDDKNLEKVRSLWNLLKRYSYGSKGFLVV
AESFDRVLKLIRDFGVKGVIKGLRPNDLNSEVSEITEDFKMFPVPVYYPLIALPEEYIKS
VKERLGL
Download sequence
Identical sequences O59053
1vbk_A 1vbk_B 70601.PH1313 pho001001313.1 pho001001313.2 pho001001313.3 gi|14591125|ref|NP_143200.1| WP_010885404.1.38245 1vbkA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]