SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ve2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ve2A
Domain Number 1 Region: 2-224
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 5.27e-99
Family Tetrapyrrole methylase 0.000000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ve2A   PDB: 1ve2
Sequence length 235
Comment (A:)
Sequence
MRGKVYLVGAGFGGPEHLTLKALRVLEVAEVVLHDRLVHPGVLALAKGELVPVGKEGYGG
KTPQEAITARLIALAREGRVVARLKGGDPMVFGRGGEEALALRRAGIPFEVVPGVTSAVG
ALSALGLPLTHRGLARSFAVATGHDPALPLPRADTLVLLMPLHTLGGLKERLLERFPPET
PLALLARVGWPGEAVRLGRVEDLPGLGEGLPSPALLVVGKVVGLYGELLPKDHGL
Download sequence
Identical sequences F6DJS4 Q53WA2 Q746N6
gi|384432439|ref|YP_005641798.1| 1ve2A gi|46255088|ref|YP_006000.1| ttk003000205.1 262724.TT_P0017 300852.TTHB060 gi|55978243|ref|YP_145299.1| d1ve2a1 1ve2_A 1ve2_B gi|384432439|ref|YP_005641798.1|NC_017273 gi|46255088|ref|YP_006000.1|NC_005838 gi|55978243|ref|YP_145299.1|NC_006462 WP_011174541.1.52262 WP_011174541.1.85415 WP_011174541.1.96068 YP_145299.1.19876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]